PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00003.1.g04810.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 371aa    MW: 38600.8 Da    PI: 9.4403
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00003.1.g04810.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.7e-3983143262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e alkcprCdstntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+n++ss
  Zjn_sc00003.1.g04810.1.am.mk  83 PEPALKCPRCDSTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGSLRNVPVGGGCRRNRRSS 143
                                   67899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3667141IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3286141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.69387141IPR003851Zinc finger, Dof-type
PROSITE patternPS01361089125IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MVFASVPAYQ DPPNWNNQQG QQPRASGGGD APLLPVDPAA ATATPPEATG LPSSSTAASA  60
SVATQARPNS MAERARLARM PQPEPALKCP RCDSTNTKFC YYNNYSLSQP RHFCKTCRRY  120
WTRGGSLRNV PVGGGCRRNR RSSKSSSSGA SSSSSKPSSS ARQLPSGPSS TPSTPGGITG  180
GIIPPGLGSL SHQYLPFLGS MHQPGGNLGL TFSAGLPPLG MQHVDAVDQF PVASGGASLD  240
QWRVHQQQPQ QQFPFLAGGV LDLQPRPQMY QLGLEANRGS GGSAASAFTL GQASGTTARE  300
GPMKLDLDDS KGQEMSLQRQ YMAALRHGED IWDGNTGGSA GDGRGNDGAG WPMNVPGFRS  360
SSTGGDGSGL L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127140RNVPVGGGCRRNRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984738.11e-140PREDICTED: dof zinc finger protein DOF3.6 isoform X2
TrEMBLK4ABE01e-140K4ABE0_SETIT; Uncharacterized protein
STRINGSi036197m1e-139(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.31e-41OBF-binding protein 3